McDonnell Genome Institute

Washington University

Transcript

lnc-SEPT11-4:1

Chromosome

chr4

Gene Name

lnc-SEPT11-4

Start

76891033

CPC Label

noncoding

End

76891445

Cancer

HCC

Strand

+

Peptide

DDVQTVQGHCK

Modified Peptide

n[230]DDVQTVQGHCK

Peptide Length

11

ORF Length

98

Open Reading Frame (ORF)

MTIRKDDVQTVQGHCKGQQIGHVLKVYRKKDVIYTEWVQQQKANGTTVRVGIHPSKVVITRLKVDKDHKKIHEQKAKSCQVGKKKGKYKKETIEKIQE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.13773

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8333

PhyloCSF Frame 3

0

CNTI Score

-0.306180879