McDonnell Genome Institute

Washington University

Transcript

lnc-SEPT11-2:1

Chromosome

chr4

Gene Name

lnc-SEPT11-2

Start

77075976

CPC Label

noncoding

End

77078696

Cancer

OV

Strand

+

Peptide

LFLPAAFPVQR

Modified Peptide

n[145]LFLPAAFPVQR

Peptide Length

11

ORF Length

63

Open Reading Frame (ORF)

LFLPAAFPVQRKYREVRPKGDGLGKSLALGWKEGGRFLVAKKSRRSVDSFSLKERKGCLQTAR

Conservation Score

1

PhyloCSF Frame 1

-4.606

No. of Spectra

1

CPC Coding Probability

0.0286812

PhyloCSF Frame 2 

-3.734

CNTI Index

coding

Max Probability

0.9127

PhyloCSF Frame 3

-2.339

CNTI Score

0.584158287