McDonnell Genome Institute

Washington University

Transcript

lnc-SEPT1-1:1

Chromosome

chr16

Gene Name

lnc-SEPT1-1

Start

30382751

CPC Label

noncoding

End

30395991

Cancer

OV

Strand

-

Peptide

GALPLPSAGQR

Modified Peptide

n[145]GALPLPSAGQR

Peptide Length

11

ORF Length

167

Open Reading Frame (ORF)

LSVAAHGRGPHLCGRLSVAPSPPGGGDLGPKALPRAPSPARRPEQGDRQHPAVTQPCVARGALPLPSAGQRGHRAASGPRDGRGARPSVAQAGLELLGSSCPPSSASQSAEITGESHLARPGNCFLISSSKPSSPLLTKGATSFLSAHTPCLTTMMELQWDLESRCV

Conservation Score

1

PhyloCSF Frame 1

0.248

No. of Spectra

3

CPC Coding Probability

0.0244851

PhyloCSF Frame 2 

5.052

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

0

CNTI Score

-0.304341576