McDonnell Genome Institute

Washington University

Transcript

lnc-SEPSECS-4:2

Chromosome

chr4

Gene Name

lnc-SEPSECS-4

Start

25219951

CPC Label

noncoding

End

25233855

Cancer

HCC

Strand

-

Peptide

LVMLTFAGQISPRQVVLEVPK

Modified Peptide

n[230]LVM[147]LTFAGQISPRQVVLEVPK

Peptide Length

21

ORF Length

36

Open Reading Frame (ORF)

LVMLTFAGQISPRQVVLEVPKTTTRLFTRRTHRAQI

Conservation Score

0.674

PhyloCSF Frame 1

-4.907

No. of Spectra

1

CPC Coding Probability

0.213224

PhyloCSF Frame 2 

-5.023

CNTI Index

noncoding

Max Probability

0.0594

PhyloCSF Frame 3

-4.756

CNTI Score

-0.357226797