McDonnell Genome Institute

Washington University

Transcript

lnc-SENP2-2:2

Chromosome

chr3

Gene Name

lnc-SENP2-2

Start

185825155

CPC Label

noncoding

End

185839230

Cancer

BRCA-Luminal B

Strand

+

Peptide

SDLAGAGALR

Modified Peptide

n[145]SDLAGAGALR

Peptide Length

10

ORF Length

219

Open Reading Frame (ORF)

LPPRGRVPGRAAARGQSALSASLSLPLKAVAGGGAAAGGGSAPRVCLCESLYGRVRSREGASERPLPAPRRCAPRLAPTALGSGCSGSGPAPGGRKRVAAPGWGSGRRNPGRARRRGRASGGAGKARPGRGWERARGRRGAAGVGGRGAASERGEGCAQGGPDVSALLPGQAGRCVPEVRGEGRLGDNNFRSDLAGAGALRVPGPCARSETRSPPRSLR

Conservation Score

1

PhyloCSF Frame 1

2.405

No. of Spectra

1

CPC Coding Probability

0.127913

PhyloCSF Frame 2 

3.022

CNTI Index

coding

Max Probability

0.209

PhyloCSF Frame 3

4.064

CNTI Score

0.737134714