McDonnell Genome Institute

Washington University

Transcript

lnc-SENP2-2:1

Chromosome

chr3

Gene Name

lnc-SENP2-2

Start

185825155

CPC Label

noncoding

End

185833168

Cancer

LUAD

Strand

+

Peptide

LFPSDSFGQDSDK

Modified Peptide

n[272]LFPSDSFGQDSDK

Peptide Length

13

ORF Length

34

Open Reading Frame (ORF)

LFPSDSFGQDSDKVAGTSFLNPSFQVRKLKLRKV

Conservation Score

0.229

PhyloCSF Frame 1

-6.095

No. of Spectra

7

CPC Coding Probability

0.13509

PhyloCSF Frame 2 

-5.349

CNTI Index

noncoding

Max Probability

0.9959

PhyloCSF Frame 3

-5.453

CNTI Score

-0.366935179