McDonnell Genome Institute

Washington University

Transcript

lnc-SENP2-10:1

Chromosome

chr3

Gene Name

lnc-SENP2-10

Start

185959961

CPC Label

noncoding

End

185975198

Cancer

OV

Strand

+

Peptide

GDLNDKASVDSALKGEAGGR

Modified Peptide

n[145]GDLNDKASVDSALKGEAGGR

Peptide Length

20

ORF Length

63

Open Reading Frame (ORF)

LELQRLGAEVVKGDLNDKASVDSALKGEAGGRLRQAPGSEARGVQRPGERQATDGWQAGGAAL

Conservation Score

1

PhyloCSF Frame 1

7.295

No. of Spectra

1

CPC Coding Probability

0.0652732

PhyloCSF Frame 2 

7.552

CNTI Index

coding

Max Probability

0.2497

PhyloCSF Frame 3

-4.58

CNTI Score

0.729659625