McDonnell Genome Institute

Washington University

Transcript

lnc-SEMG2-3:1

Chromosome

chr20

Gene Name

lnc-SEMG2-3

Start

45230727

CPC Label

noncoding

End

45246991

Cancer

OV

Strand

+

Peptide

DDSGENIFK

Modified Peptide

n[145]DDSGENIFK

Peptide Length

9

ORF Length

58

Open Reading Frame (ORF)

LYSYQNKKSCKFKNQQEISKTKNIVNERDDSGENIFKSHPAECLLISRGSTSWSLNCL

Conservation Score

0.043

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0920897

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8574

PhyloCSF Frame 3

0

CNTI Score

-0.340238725