McDonnell Genome Institute

Washington University

Transcript

lnc-SEMA6D-2:1

Chromosome

chr15

Gene Name

lnc-SEMA6D-2

Start

46693287

CPC Label

noncoding

End

46804844

Cancer

LUAD

Strand

+

Peptide

QGFPLSQLLFNIVLEVLAR

Modified Peptide

n[230]QGFPLSQLLFNIVLEVLAR

Peptide Length

19

ORF Length

74

Open Reading Frame (ORF)

LSPETGRTQPSVRMRKRQKQEAFSLRTVTRQGFPLSQLLFNIVLEVLARAIRQQKEESSKQEKQKSNYLSSLMI

Conservation Score

0.376

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0594077

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7257

PhyloCSF Frame 3

0

CNTI Score

-0.347815132