McDonnell Genome Institute

Washington University

Transcript

lnc-SEMA6A-7:1

Chromosome

chr5

Gene Name

lnc-SEMA6A-7

Start

116218025

CPC Label

noncoding

End

116218295

Cancer

BRCA-Luminal B

Strand

-

Peptide

EGNNPAENGDVK

Modified Peptide

n[145]EGNNPAENGDVK

Peptide Length

12

ORF Length

90

Open Reading Frame (ORF)

MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPASPKPEPRPKKAPAKKGEKVPKGRKGKADAGKEGNNPAENGDVKTDQAQKAEGAGGAK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.138043

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.326041273