McDonnell Genome Institute

Washington University

Transcript

lnc-SEMA3A-1:1

Chromosome

chr7

Gene Name

lnc-SEMA3A-1

Start

84528121

CPC Label

noncoding

End

84528830

Cancer

EOGC

Strand

-

Peptide

SVNELIYKHDYGKISK

Modified Peptide

n[145]SVNELIYKHDYGKISK

Peptide Length

16

ORF Length

34

Open Reading Frame (ORF)

MLRIVEPYFAWEYPNLKSVNELIYKHDYGKISKK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0432478

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5141

PhyloCSF Frame 3

0

CNTI Score

-0.393400077