McDonnell Genome Institute

Washington University

Transcript

lnc-SELENOT-45:1

Chromosome

chr3

Gene Name

lnc-SELENOT-45

Start

150761936

CPC Label

noncoding

End

150774740

Cancer

EOGC

Strand

+

Peptide

LLLPLLSSPTWLWPR

Modified Peptide

n[145]LLLPLLSSPTWLWPR

Peptide Length

15

ORF Length

58

Open Reading Frame (ORF)

LSMLQKFQEKVEKLLLPLLSSPTWLWPRYCPVCLASTPGGVLMSPSLQLSQILCVLHT

Conservation Score

0.233

PhyloCSF Frame 1

-6.009

No. of Spectra

22

CPC Coding Probability

0.263303

PhyloCSF Frame 2 

-4.386

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

-4.521

CNTI Score

-0.326414376