McDonnell Genome Institute

Washington University

Transcript

lnc-SELENOP-6:2

Chromosome

chr5

Gene Name

lnc-SELENOP-6

Start

42949431

CPC Label

noncoding

End

42950626

Cancer

CCRC

Strand

-

Peptide

GADLGLR

Modified Peptide

n[230]GADLGLR

Peptide Length

7

ORF Length

65

Open Reading Frame (ORF)

LYFYLNVMYFFLLILNVSASCSLTCMLRTRGADLGLRLAAARSRVLSGDSASYAELSVLRQHFCQ

Conservation Score

0.175

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.025427

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9959

PhyloCSF Frame 3

-4.088

CNTI Score

-0.384711189