McDonnell Genome Institute

Washington University

Transcript

lnc-SELENOK-3:2

Chromosome

chr3

Gene Name

lnc-SELENOK-3

Start

54047748

CPC Label

noncoding

End

54048793

Cancer

OSCC

Strand

-

Peptide

MISNLQDDR

Modified Peptide

n[145]MISNLQDDR

Peptide Length

9

ORF Length

50

Open Reading Frame (ORF)

LIRINKVTHHCHLHLGLFPKQLCLSNPKDPQFLQHPPTYKMISNLQDDRR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.0368351

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.928

PhyloCSF Frame 3

0

CNTI Score

-0.383512344