McDonnell Genome Institute

Washington University

Transcript

lnc-SELENOK-1:2

Chromosome

chr3

Gene Name

lnc-SELENOK-1

Start

54014229

CPC Label

noncoding

End

54031429

Cancer

CCRC

Strand

-

Peptide

LGGGAYR

Modified Peptide

n[230]LGGGAYR

Peptide Length

7

ORF Length

63

Open Reading Frame (ORF)

LKLGGGAYRFQPARRGKRVQRTHLHCPRPRPVASILAPLRFHSQKPSPKGVLQRRKNHHKTGH

Conservation Score

0.909

PhyloCSF Frame 1

-5.057

No. of Spectra

8

CPC Coding Probability

0.0320887

PhyloCSF Frame 2 

-4.389

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

-4.682

CNTI Score

-0.416859772