McDonnell Genome Institute

Washington University

Transcript

lnc-SELENOF-8:1

Chromosome

chr1

Gene Name

lnc-SELENOF-8

Start

87044934

CPC Label

coding

End

87045871

Cancer

BRCA-Luminal B

Strand

-

Peptide

DVEFEVLVMPQK

Modified Peptide

n[145]DVEFEVLVMPQK

Peptide Length

12

ORF Length

136

Open Reading Frame (ORF)

LCLVHWILPTPIVTYVPASQVTVRLNVHKVTVLTLRDKVVKQKFAMVAPDVQIEDGKGTILISSEKGETEANNHKKLSEFGMRNCSWLQADYFLQDYTLLINILHSEDLGKDVEFEVLVMPQKKWGQNKLKMLPKA

Conservation Score

1

PhyloCSF Frame 1

-3.41

No. of Spectra

1

CPC Coding Probability

0.642534

PhyloCSF Frame 2 

-3.681

CNTI Index

coding

Max Probability

0.5351

PhyloCSF Frame 3

-4.499

CNTI Score

0.688624561