McDonnell Genome Institute

Washington University

Transcript

lnc-SEL1L3-2:2

Chromosome

chr4

Gene Name

lnc-SEL1L3-2

Start

25531039

CPC Label

noncoding

End

25569346

Cancer

OV

Strand

-

Peptide

AMSAESGQQDLGLK

Modified Peptide

n[145]AMSAESGQQDLGLK

Peptide Length

14

ORF Length

53

Open Reading Frame (ORF)

LPFFEGLYKIVSCKLKWLGSPAEGYFYPKAMSAESGQQDLGLKKLRLNFRSDI

Conservation Score

0.302

PhyloCSF Frame 1

-4.901

No. of Spectra

1

CPC Coding Probability

0.113107

PhyloCSF Frame 2 

-3.806

CNTI Index

noncoding

Max Probability

0.0533

PhyloCSF Frame 3

-4.873

CNTI Score

-0.335372228