McDonnell Genome Institute

Washington University

Transcript

lnc-SEH1L-3:1

Chromosome

chr18

Gene Name

lnc-SEH1L-3

Start

12912843

CPC Label

coding

End

12913906

Cancer

BRCA-Basal-like

Strand

+

Peptide

LTEKMHAADLTVSALR

Modified Peptide

n[145]LTEKMHAADLTVSALR

Peptide Length

16

ORF Length

51

Open Reading Frame (ORF)

LTEKMHAADLTVSALRGDMDEKERDVIMREFQPGSNRVLITTDLVCGTDVQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.820571

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6288

PhyloCSF Frame 3

0

CNTI Score

0.594512362