McDonnell Genome Institute

Washington University

Transcript

lnc-SECTM1-1:1

Chromosome

chr17

Gene Name

lnc-SECTM1-1

Start

82353753

CPC Label

noncoding

End

82357146

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

HPPNIPGLLAFEHPR

Modified Peptide

n[145]HPPNIPGLLAFEHPR

Peptide Length

15

ORF Length

38

Open Reading Frame (ORF)

LSLHCQPFLEVWVPSGLGILKHPPNIPGLLAFEHPRGA

Conservation Score

0.022

PhyloCSF Frame 1

-5.857

No. of Spectra

14

CPC Coding Probability

0.103634

PhyloCSF Frame 2 

-5.344

CNTI Index

noncoding

Max Probability

0.7548

PhyloCSF Frame 3

-4.899

CNTI Score

-0.327480169