McDonnell Genome Institute

Washington University

Transcript

lnc-SEC61B-1:1

Chromosome

chr9

Gene Name

lnc-SEC61B-1

Start

99237964

CPC Label

noncoding

End

99241904

Cancer

OV

Strand

+

Peptide

GTFEITLFLGSRR

Modified Peptide

n[145]GTFEITLFLGSRR

Peptide Length

13

ORF Length

96

Open Reading Frame (ORF)

LRMKRNPDDPGTFYRQGLNDPKGTFEITLFLGSRRLVNDTIHPCLFIVIKYQNKEIRAHEVLRPHHSGCLAAFMMRRLWVFNKVSDMSNKILPWPC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.085526

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9697

PhyloCSF Frame 3

0

CNTI Score

-0.349209272