McDonnell Genome Institute

Washington University

Transcript

lnc-SEC24D-3:1

Chromosome

chr4

Gene Name

lnc-SEC24D-3

Start

118635969

CPC Label

noncoding

End

118638782

Cancer

CCRC

Strand

-

Peptide

ACGSGAYQR

Modified Peptide

n[230]ACGSGAYQR

Peptide Length

9

ORF Length

182

Open Reading Frame (ORF)

LHKEQDSSSEKDGRSPNKWDKDHIQWPMSGGHDLQQAAPGPGRAHQGHPNQDNRTVSQMLSERWYTLGPNETQKYHDLAFQVKVAHLQQGPKEVQLRGQAHKPGASRSVTRACGSGAYQRRALPLPLGCPLNSCQLQPKHSRARIPRSSFCGAERLHTVREPGSAWPKPSPTGGYTAWMAGK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.337822

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9965

PhyloCSF Frame 3

0

CNTI Score

0.701604275