McDonnell Genome Institute

Washington University

Transcript

lnc-SEC24D-1:2

Chromosome

chr4

Gene Name

lnc-SEC24D-1

Start

118671006

CPC Label

noncoding

End

118675729

Cancer

OV

Strand

-

Peptide

VAGITGSHHHNWLIFVFLEETGFHHVGQAGLK

Modified Peptide

n[145]VAGITGSHHHNWLIFVFLEETGFHHVGQAGLK

Peptide Length

32

ORF Length

97

Open Reading Frame (ORF)

LKQSLSLSPKLECSGVILAHCNLHFPGSSNSPASAFRVAGITGSHHHNWLIFVFLEETGFHHVGQAGLKLLTSGDLPTSASQSAGFTGGATTPSLTE

Conservation Score

0.476

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.298532

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9971

PhyloCSF Frame 3

0

CNTI Score

-0.352687004