McDonnell Genome Institute

Washington University

Transcript

lnc-SEC24D-1:11

Chromosome

chr4

Gene Name

lnc-SEC24D-1

Start

118677871

CPC Label

noncoding

End

118685320

Cancer

OV

Strand

-

Peptide

DSLPCSVLVGHHCIK

Modified Peptide

n[145]DSLPCSVLVGHHCIK

Peptide Length

15

ORF Length

35

Open Reading Frame (ORF)

LSLFCDFRDSLPCSVLVGHHCIKVISHDNYKKLRK

Conservation Score

0.175

PhyloCSF Frame 1

-4.591

No. of Spectra

3

CPC Coding Probability

0.128492

PhyloCSF Frame 2 

-4.809

CNTI Index

noncoding

Max Probability

0.9422

PhyloCSF Frame 3

-5.746

CNTI Score

-0.367488613