McDonnell Genome Institute

Washington University

Transcript

lnc-SEC24C-5:2

Chromosome

chr10

Gene Name

lnc-SEC24C-5

Start

73625942

CPC Label

noncoding

End

73631476

Cancer

PRAD

Strand

+

Peptide

KTIEILGPK

Modified Peptide

‚Äč

Peptide Length

9

ORF Length

89

Open Reading Frame (ORF)

LSPKKKRKTIEILGPKSLHSNQAPRNTDAAANPWTTFCFFVFFFLFFCFFEMEFHSSCSGWIAMARSRVTATSTSRVQVILLPQPPKYK

Conservation Score

0.462

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.121505

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9947

PhyloCSF Frame 3

0

CNTI Score

-0.334268935