McDonnell Genome Institute

Washington University

Transcript

lnc-SEC24C-5:1

Chromosome

chr10

Gene Name

lnc-SEC24C-5

Start

73601522

CPC Label

noncoding

End

73626668

Cancer

CCRC

Strand

+

Peptide

FTGVPDR

Modified Peptide

n[230]FTGVPDR

Peptide Length

7

ORF Length

53

Open Reading Frame (ORF)

LPAIALFKMAASRRFTGVPDRRGGGAQARMKLELARSRKTIAGGTASVGAEET

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0480825

PhyloCSF Frame 2 

1.541

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

0

CNTI Score

-0.346808102