McDonnell Genome Institute

Washington University

Transcript

lnc-SEC23A-4:1

Chromosome

chr14

Gene Name

lnc-SEC23A-4

Start

38973398

CPC Label

noncoding

End

38974085

Cancer

OSCC

Strand

-

Peptide

MSLIQMMK

Modified Peptide

n[145]M[147]SLIQMMK

Peptide Length

8

ORF Length

40

Open Reading Frame (ORF)

MSLIQMMKSKRKKLALPFSVQGGGRSGGKCPLGERAETGS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0587754

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8687

PhyloCSF Frame 3

0

CNTI Score

-0.375563105