McDonnell Genome Institute

Washington University

Transcript

lnc-SEC22A-14:6

Chromosome

chr3

Gene Name

lnc-SEC22A-14

Start

123585581

CPC Label

noncoding

End

123612598

Cancer

CCRC

Strand

+

Peptide

HTHNIHAHK

Modified Peptide

n[230]HTHNIHAHK

Peptide Length

9

ORF Length

34

Open Reading Frame (ORF)

MHTHNIHAHKGYILNTKVIEKSFECAKSNKNPLL

Conservation Score

1

PhyloCSF Frame 1

-3.233

No. of Spectra

4

CPC Coding Probability

0.0464109

PhyloCSF Frame 2 

-4.669

CNTI Index

noncoding

Max Probability

0.6911

PhyloCSF Frame 3

-2.8

CNTI Score

-0.401202991