McDonnell Genome Institute

Washington University

Transcript

lnc-SEC22A-14:1

Chromosome

chr3

Gene Name

lnc-SEC22A-14

Start

123585316

CPC Label

noncoding

End

123607356

Cancer

OV

Strand

+

Peptide

AYIWDAFLQKDFYIPLLK

Modified Peptide

n[145]AYIWDAFLQKDFYIPLLK

Peptide Length

18

ORF Length

53

Open Reading Frame (ORF)

MEIPRAYIWDAFLQKDFYIPLLKARWHPDHFSVRFKDPGASASSCCHGSRFSF

Conservation Score

0.532

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0732561

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.317

PhyloCSF Frame 3

0

CNTI Score

-0.338196251