McDonnell Genome Institute

Washington University

Transcript

lnc-SDSL-6:2

Chromosome

chr12

Gene Name

lnc-SDSL-6

Start

114077145

CPC Label

noncoding

End

114095184

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

DLHSQGLDLNK

Modified Peptide

n[145]DLHSQGLDLNK

Peptide Length

11

ORF Length

84

Open Reading Frame (ORF)

MGDSMQMVYREKIDTRDLHSQGLDLNKSVSSYVLDTEDCARHPLELLSGPLARRAHLREKGQCDSLISLWKDLSSQRCLPVLFV

Conservation Score

0.155

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.165343

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.422901746