McDonnell Genome Institute

Washington University

Transcript

lnc-SDK2-7:1

Chromosome

chr17

Gene Name

lnc-SDK2-7

Start

73733186

CPC Label

noncoding

End

73748609

Cancer

CCRC

Strand

-

Peptide

LTGLGSGDTEMGEK

Modified Peptide

n[43]LTGLGSGDTEMGEK

Peptide Length

14

ORF Length

74

Open Reading Frame (ORF)

LTGLGSGDTEMGEKQSVISRHLSQAERWQCYQFRCGRLARFCGYQLHVNSSVFSFLCLLHPPLQAPALPEETWF

Conservation Score

0.042

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.157098

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

0

CNTI Score

-0.313843969