McDonnell Genome Institute

Washington University

Transcript

lnc-SCUBE3-2:1

Chromosome

chr6

Gene Name

lnc-SCUBE3-2

Start

35199347

CPC Label

noncoding

End

35200218

Cancer

OV

Strand

+

Peptide

MDPLLGALNAQLGLGITGPLSGMSRK

Modified Peptide

n[145]MDPLLGALNAQLGLGITGPLSGMSRK

Peptide Length

26

ORF Length

52

Open Reading Frame (ORF)

MDPLLGALNAQLGLGITGPLSGMSRKENHVPKTDHFLCRIVCGQCSNAQDLQ

Conservation Score

0.957

PhyloCSF Frame 1

-4.289

No. of Spectra

12

CPC Coding Probability

0.116199

PhyloCSF Frame 2 

-5.662

CNTI Index

noncoding

Max Probability

0.9886

PhyloCSF Frame 3

-2.975

CNTI Score

-0.423682493