McDonnell Genome Institute

Washington University

Transcript

lnc-SCUBE1-1:4

Chromosome

chr22

Gene Name

lnc-SCUBE1-1

Start

43385085

CPC Label

noncoding

End

43388244

Cancer

OSCC

Strand

-

Peptide

LHGITASVQK

Modified Peptide

n[145]LHGITASVQK

Peptide Length

10

ORF Length

49

Open Reading Frame (ORF)

LPGWGAANNQKKHGTTDQVQVSISQKWRLHGITASVQKKRRLQRLTQFA

Conservation Score

0.021

PhyloCSF Frame 1

-4.559

No. of Spectra

7

CPC Coding Probability

0.0372221

PhyloCSF Frame 2 

-4.828

CNTI Index

noncoding

Max Probability

0.9821

PhyloCSF Frame 3

-3.752

CNTI Score

-0.303650428