McDonnell Genome Institute

Washington University

Transcript

lnc-SCRN3-3:1

Chromosome

chr2

Gene Name

lnc-SCRN3-3

Start

174547140

CPC Label

noncoding

End

174774827

Cancer

HCC

Strand

+

Peptide

LRRFVGYLK

Modified Peptide

n[43]LRRFVGYLK

Peptide Length

9

ORF Length

59

Open Reading Frame (ORF)

LRRFVGYLKCTPTFGIFSKGKKDLFSILFFCWTEPVPRLDHVGSWVYFSYISKRCCDLE

Conservation Score

1

PhyloCSF Frame 1

-4.542

No. of Spectra

1

CPC Coding Probability

0.0884669

PhyloCSF Frame 2 

-4.585

CNTI Index

noncoding

Max Probability

0.5678

PhyloCSF Frame 3

-2.857

CNTI Score

-0.359283235