McDonnell Genome Institute

Washington University

Transcript

lnc-SCRN3-11:1

Chromosome

chr2

Gene Name

lnc-SCRN3-11

Start

175184214

CPC Label

noncoding

End

175184607

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

FESLMITELGK

Modified Peptide

n[145]FESLMITELGK

Peptide Length

11

ORF Length

72

Open Reading Frame (ORF)

MVHMNVLPDALKSINNAERRGKPQVLIRLCSKIIIWFLTVMVKYGYIGKFESLMITELGKIVVNLTGRLNKR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.126397

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9634

PhyloCSF Frame 3

0

CNTI Score

-0.38102793