McDonnell Genome Institute

Washington University

Transcript

lnc-SCRN1-1:1

Chromosome

chr7

Gene Name

lnc-SCRN1-1

Start

29598794

CPC Label

noncoding

End

29685255

Cancer

BRCA-Basal-like

Strand

-

Peptide

GGPAAVSSGGRGVGGLR

Modified Peptide

n[145]GGPAAVSSGGRGVGGLR

Peptide Length

17

ORF Length

122

Open Reading Frame (ORF)

LPSWLSGHSARPGPEQGGHERQAERPGRRSRRTRAYSARIYLPVAAEWPMGPGPEPGAGGRRRGEVPGPGAQRSPARRRRGGPAAVSSGGRGVGGLRGAVLFQHPEQQQRPVGLAGLGAQQP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.0416261

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9949

PhyloCSF Frame 3

0

CNTI Score

-0.268411892