McDonnell Genome Institute

Washington University

Transcript

lnc-SCP2-2:1

Chromosome

chr1

Gene Name

lnc-SCP2-2

Start

52920099

CPC Label

noncoding

End

52921268

Cancer

OV

Strand

+

Peptide

LVVKPVK

Modified Peptide

n[145]LVVKPVK

Peptide Length

7

ORF Length

67

Open Reading Frame (ORF)

MHTWEQWATAGSKELDFMAKPRFKLVVKPVKRKQYCWGRGGRRHVRPRRKIRLSSRNKKRSRRNSRS

Conservation Score

0.906

PhyloCSF Frame 1

0

No. of Spectra

27

CPC Coding Probability

0.0876183

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.994

PhyloCSF Frame 3

0

CNTI Score

-0.332933737