McDonnell Genome Institute

Washington University

Transcript

lnc-SCOC-3:1

Chromosome

chr4

Gene Name

lnc-SCOC-3

Start

140095877

CPC Label

noncoding

End

140097980

Cancer

OV

Strand

+

Peptide

ELSGQNDGK

Modified Peptide

n[145]ELSGQNDGK

Peptide Length

9

ORF Length

39

Open Reading Frame (ORF)

LKEDGVKSGQKKKKVNFINNTKELSGQNDGKEAKVWPLI

Conservation Score

0.996

PhyloCSF Frame 1

-3.119

No. of Spectra

1

CPC Coding Probability

0.0143599

PhyloCSF Frame 2 

-2.98

CNTI Index

noncoding

Max Probability

0.1004

PhyloCSF Frame 3

-4.589

CNTI Score

-0.373235041