McDonnell Genome Institute

Washington University

Transcript

lnc-SCO1-2:1

Chromosome

chr17

Gene Name

lnc-SCO1-2

Start

10715942

CPC Label

noncoding

End

10716582

Cancer

LUAD

Strand

-

Peptide

SIIDDSEITK

Modified Peptide

n[230]SIIDDSEITK

Peptide Length

10

ORF Length

93

Open Reading Frame (ORF)

LTGREIKISQHSNYKNDVMIRKEAYVHKSMMEELKSIIDDSEITKEDDALWPPPNREGRQELEIIIGDEHISFTTSKIGSLIDVSQSKDPEGL

Conservation Score

1

PhyloCSF Frame 1

-3.041

No. of Spectra

1

CPC Coding Probability

0.284303

PhyloCSF Frame 2 

-3.992

CNTI Index

coding

Max Probability

0.3563

PhyloCSF Frame 3

-2.661

CNTI Score

0.64444436