McDonnell Genome Institute

Washington University

Transcript

lnc-SCO1-1:1

Chromosome

chr17

Gene Name

lnc-SCO1-1

Start

10672473

CPC Label

noncoding

End

10676006

Cancer

OV

Strand

-

Peptide

QMVGEWASGVVWQSR

Modified Peptide

n[145]QM[147]VGEWASGVVWQSR

Peptide Length

15

ORF Length

48

Open Reading Frame (ORF)

LKEDSVEKVSASFSNSRRQMVGEWASGVVWQSRVATLRPQRQCLLTLS

Conservation Score

0.089

PhyloCSF Frame 1

-4.233

No. of Spectra

1

CPC Coding Probability

0.0490952

PhyloCSF Frame 2 

-4.711

CNTI Index

noncoding

Max Probability

0.4209

PhyloCSF Frame 3

-4.469

CNTI Score

-0.336040919