McDonnell Genome Institute

Washington University

Transcript

lnc-SCN8A-2:6

Chromosome

chr12

Gene Name

lnc-SCN8A-2

Start

51817898

CPC Label

noncoding

End

51820150

Cancer

CCRC

Strand

+

Peptide

SNILSEVSFFLSCQK

Modified Peptide

n[230]SNILSEVSFFLSCQK

Peptide Length

15

ORF Length

87

Open Reading Frame (ORF)

LLLTRNSWGFTEASGSSSPLPRKSHFLSVWENLVPWMEWGGGGRCEGHTGEQPKSNILSEVSFFLSCQKKKKNSKFYTFYKNKKTKI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.1143

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7933

PhyloCSF Frame 3

0

CNTI Score

-0.322352188