McDonnell Genome Institute

Washington University

Transcript

lnc-SCN2A-6:3

Chromosome

chr2

Gene Name

lnc-SCN2A-6

Start

164959249

CPC Label

noncoding

End

164963071

Cancer

PRAD

Strand

+

Peptide

ISVTSFIIYLCYEHSK

Modified Peptide

ISVTSFIIYLCYEHSK

Peptide Length

16

ORF Length

35

Open Reading Frame (ORF)

MYKMCKDHIRIIRISVTSFIIYLCYEHSKSSLLSF

Conservation Score

0.23

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0220367

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8861

PhyloCSF Frame 3

0

CNTI Score

-0.39886438