McDonnell Genome Institute

Washington University

Transcript

lnc-SCLT1-7:1

Chromosome

chr4

Gene Name

lnc-SCLT1-7

Start

130503356

CPC Label

noncoding

End

130504344

Cancer

CCRC

Strand

-

Peptide

LAISGAR

Modified Peptide

n[230]LAISGAR

Peptide Length

7

ORF Length

84

Open Reading Frame (ORF)

LAISGARSPGLFLSLSQWILLPSMTPSLVSTLLSICSSMILSMSGSMTQSRLRTGSLPSKGSPCLFSRSEIPLSNRVMLVLNML

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.0733731

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9958

PhyloCSF Frame 3

0

CNTI Score

-0.406324518