McDonnell Genome Institute

Washington University

Transcript

lnc-SCLT1-6:1

Chromosome

chr4

Gene Name

lnc-SCLT1-6

Start

129943621

CPC Label

noncoding

End

129990928

Cancer

OV

Strand

-

Peptide

SPGADGFTATFYK

Modified Peptide

n[145]SPGADGFTATFYK

Peptide Length

13

ORF Length

126

Open Reading Frame (ORF)

MDKFLDTCTLPRLNQEEVKSLNRPITSSEIEAVINSLPTKRSPGADGFTATFYKRYKGELVPFLLKLFKTIEKERLLPYSFYEASLILISKPGRDTTKKENFRPISLMNITAKILNKILATNPAAH

Conservation Score

0.602

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.342793

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.951

PhyloCSF Frame 3

0

CNTI Score

-0.325393476