McDonnell Genome Institute

Washington University

Transcript

lnc-SCIMP-1:1

Chromosome

chr17

Gene Name

lnc-SCIMP-1

Start

5239132

CPC Label

noncoding

End

5242626

Cancer

OV

Strand

-

Peptide

VGSGGTFPQK

Modified Peptide

n[145]VGSGGTFPQK

Peptide Length

10

ORF Length

66

Open Reading Frame (ORF)

LIKRVGSGGTFPQKKGLLFTEEGVKSWEGKITGVHSAVIERPTRHAVCSKMGVMLCPWRRGSGARG

Conservation Score

0.196

PhyloCSF Frame 1

-3.853

No. of Spectra

1

CPC Coding Probability

0.0487563

PhyloCSF Frame 2 

-3.441

CNTI Index

noncoding

Max Probability

0.3815

PhyloCSF Frame 3

-4.241

CNTI Score

-0.346396977