McDonnell Genome Institute

Washington University

Transcript

lnc-SCGB3A1-3:4

Chromosome

chr5

Gene Name

lnc-SCGB3A1-3

Start

180462883

CPC Label

noncoding

End

180494207

Cancer

OSCC

Strand

-

Peptide

ASTSHPMLGFVAGGGPETGGGLGR

Modified Peptide

n[145]ASTSHPM[147]LGFVAGGGPETGGGLGR

Peptide Length

24

ORF Length

51

Open Reading Frame (ORF)

LLMGAEAQKTGAGKGQGVFQSQDPRASTSHPMLGFVAGGGPETGGGLGRWP

Conservation Score

0.043

PhyloCSF Frame 1

-5.297

No. of Spectra

2

CPC Coding Probability

0.335557

PhyloCSF Frame 2 

-5.213

CNTI Index

noncoding

Max Probability

0.8021

PhyloCSF Frame 3

-5.482

CNTI Score

-0.294769806