McDonnell Genome Institute

Washington University

Transcript

lnc-SCGB2B2-130:1

Chromosome

chr19

Gene Name

lnc-SCGB2B2-130

Start

34421611

CPC Label

noncoding

End

34428318

Cancer

OV

Strand

-

Peptide

ATFHAKDISI

Modified Peptide

n[145]ATFHAKDISI

Peptide Length

10

ORF Length

67

Open Reading Frame (ORF)

LLRSLLCLMCLGQILSSEEARTEVATDPYRFTAANSIVAKMLVTKGEKIRPPSYLYKATFHAKDISI

Conservation Score

0.561

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0834196

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.1248

PhyloCSF Frame 3

0

CNTI Score

0.645650559