McDonnell Genome Institute

Washington University

Transcript

lnc-SCGB2B2-12:4

Chromosome

chr19

Gene Name

lnc-SCGB2B2-12

Start

34390885

CPC Label

noncoding

End

34393295

Cancer

OSCC

Strand

-

Peptide

ILIPGPDPTSSDFDRR

Modified Peptide

n[145]ILIPGPDPTSSDFDRR

Peptide Length

16

ORF Length

202

Open Reading Frame (ORF)

LLRHGQTRILIPGPDPTSSDFDRRRSSYLYQIPTSSDIDRPRSSFLYQMVTPQTWTVLDPHTRARSYLLRHGQTQILIPGPDPTSSDTDGHRSSYLYPASLPQTLEDSGLHTCARCYLLRHWKPKGLKPESKLTSSNTGRRRSSYLCQVLPPQTWKTHILIPVPGATYSDTGRPRSSYLCQVLPPQTQEDPDPHTCARCYLL

Conservation Score

0.989

PhyloCSF Frame 1

-3.785

No. of Spectra

5

CPC Coding Probability

0.165975

PhyloCSF Frame 2 

-3.44

CNTI Index

noncoding

Max Probability

0.5795

PhyloCSF Frame 3

-1.711

CNTI Score

-0.298309526