McDonnell Genome Institute

Washington University

Transcript

lnc-SCGB2B2-12:2

Chromosome

chr19

Gene Name

lnc-SCGB2B2-12

Start

34390478

CPC Label

coding

End

34393295

Cancer

OV

Strand

-

Peptide

FLPLQILK

Modified Peptide

n[145]FLPLQILK

Peptide Length

8

ORF Length

175

Open Reading Frame (ORF)

LRQGPPPQTRTDPRPHTCARAHLLRHGHTQILILIPDPTSSDIEKPRSSYLYEILPPQILTDPDPPGTDPTSSNTDKPRSSYQGQIQPLQTLTDSDPHTCTRFLPLQILKDPDPYTCTRSYLLRHEQNQILILMPDPTCSDMDRPGFSYQGQILPPQTWTDPDPHTRTRSHLLRY

Conservation Score

0.987

PhyloCSF Frame 1

-1.763

No. of Spectra

17

CPC Coding Probability

0.719484

PhyloCSF Frame 2 

-3.382

CNTI Index

noncoding

Max Probability

0.9417

PhyloCSF Frame 3

-3.436

CNTI Score

-0.31444206