McDonnell Genome Institute

Washington University

Transcript

lnc-SCGB2B2-11:1

Chromosome

chr19

Gene Name

lnc-SCGB2B2-11

Start

34355567

CPC Label

noncoding

End

34360647

Cancer

OV

Strand

-

Peptide

QVLLIPVR

Modified Peptide

n[145]QVLLIPVR

Peptide Length

8

ORF Length

57

Open Reading Frame (ORF)

MLARMVSISRPCGPPASATYSSGITGVSHCGRQRQVLLIPVRHSISAIDWVPGLGRG

Conservation Score

0.259

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.153436

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6096

PhyloCSF Frame 3

0

CNTI Score

-0.304300302