McDonnell Genome Institute

Washington University

Transcript

lnc-SCGB1C2-8:1

Chromosome

chr17

Gene Name

lnc-SCGB1C2-8

Start

198203

CPC Label

coding

End

199837

Cancer

OV

Strand

+

Peptide

LGGLSGAGEGGSSNTPR

Modified Peptide

n[145]LGGLSGAGEGGSSNTPR

Peptide Length

17

ORF Length

68

Open Reading Frame (ORF)

LVSPGVTGCRFKRKLGGLSGAGEGGSSNTPRSGSVGTKRSPYFHSTESSKFTRHFYVDLEKGGVPSTS

Conservation Score

0.75

PhyloCSF Frame 1

-3.665

No. of Spectra

1

CPC Coding Probability

0.604091

PhyloCSF Frame 2 

-4.154

CNTI Index

noncoding

Max Probability

0.8884

PhyloCSF Frame 3

-4.365

CNTI Score

-0.392133808